Home > Product > Catalog Peptides > Others > Omega-agatoxin-Aa4b

Others

Omega-agatoxin-Aa4b

[Price Inquiry]
CAT#
A30001
Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
Modifications
D-serine (Ser)(46);Disulfide bond(4)
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.