Home > Product > Catalog Peptides > Others > Omega-hexatoxin-Hv1a

Others

warning All products are for research use only. Not for human use.

Omega-hexatoxin-Hv1a

[Price Inquiry]
CAT#
H18003
Sequence
SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD
Modifications
Disulfide bond(3)
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.