Keywords Search Google Search Search

Omega-lycotoxin-Gsp2671a

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	L13003
Sequence	EKSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW

CAT#	Product Name	Inquiry
X02650	PM_10455290	Inquiry
X17223	PM_9973484	Inquiry
S03001	[Lys4] Sarafotoxin S6c	Inquiry
X06091	PM_1381191	Inquiry
X05979	PM_1355851	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of 10Panx in the pathogenesis of epilepsy

10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Basic information of Somatostatin

The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...

Glucagon like peptide-1 (GLP-1)

GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	47
Modifications	Disulfide bond(4)