Home > Product > Catalog Peptides > Others > Omega-lycotoxin-Gsp2671b

Others

warning All products are for research use only. Not for human use.

Omega-lycotoxin-Gsp2671b

[Price Inquiry]
CAT#
L13004
Sequence
ERSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW
Modifications
Disulfide bond(4)
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.