Home > Product > Antimicrobial Peptides > Opistoporin-2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Opistoporin-2

[Price Inquiry]
CAT#
AF3090
Sequence
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
Host Chemicals
Opistophthalmus carinatus
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P83314
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.