Home > Product > Antimicrobial Peptides > Opistoporin4

Antimicrobial Peptides

Opistoporin4

[Price Inquiry]
CAT#
AF3088
Sequence
GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS
Host Chemicals
Opistophthalmus carinatus
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
Q5VJS9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.