Home > Product > Antimicrobial Peptides > Oreoch-3

Antimicrobial Peptides

CAT#
AF2125
Sequence
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ
Host Chemicals
Oreochromis niloticus
Length
32
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.