26Rfa, Hypothalamic Peptide, human

26Rfa, Hypothalamic Peptide, human is a hypothalamic neuropeptide of the RFamide peptide family with orexigenic activity. 26RFa is an orexigenic neuropeptide identified as the endogenous ligand of the orphan G protein-coupled receptor GPR103.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1138
CAS	600171-68-4
Synonyms/Alias	P518 (human), Orphan G-Protein Coupled Receptor SP9155 Agonist Peptide P518 (human)
M.F/Formula	C₁₂₇H₁₉₅N₃₇O₃₇
M.W/Mr.	2832.13
Sequence	One Letter Code: TSGPLGNLAEELNGYSRKKGGFSFRF-NH2 three Letter Code: Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2

CAT#	Product Name	Inquiry
R1667	SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1275	CEF1, Influenza Matrix Protein M1 58-66	Inquiry
R1800	γ-2-MSH (41-58), amide	Inquiry
R1859	CGRP (rat)	Inquiry
R1828	Epobis	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Length	26
Storage	-20 ± 5 °C