Home > Product > Catalog Peptides > Various Products / Diabetes > Osteocalcin (1-49) (human)

Various Products / Diabetes

Osteocalcin (1-49) (human)

Price Inquiry
CAT#
O03005
Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
M.W/Mr.
5929.52
Molecular Formula
C269H381N67O82S2
Length
49

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.