Home > Product > Catalog Peptides > Various Products / Diabetes > Osteocalcin (1-49) (human)

Various Products / Diabetes

Osteocalcin (1-49) (human)

[Price Inquiry]
CAT#
O03005
Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
M.W/Mr.
5929.52
Molecular Formula
C269H381N67O82S2
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.