Home > Product > Catalog Peptides > Others > Osteocrin_human

Others

Osteocrin_human

[Price Inquiry]
CAT#
O09001
Sequence
SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSR
Modifications
Arginine amide
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.