Home > Product > Antimicrobial Peptides > Ostricacin-2

Antimicrobial Peptides

Ostricacin-2

[Price Inquiry]
CAT#
AF2864
Sequence
APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW
Host Chemicals
Struthio camelus
Length
41
Activity
Antibacterial, Antifungal
SwissProt ID
P85114
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.