Home > Product > Catalog Peptides > Others > OVA (241-270)

Others

OVA (241-270)

[Price Inquiry]
CAT#
O05009
Sequence
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
M.W/Mr.
3421.9
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.