Home > Product > Catalog Peptides > Others > OVA (241-270)

Others

OVA (241-270)

Price Inquiry
CAT#
O05009
Sequence
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
M.W/Mr.
3421.9
Length
30

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.