Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Oxyntomodulin / Glucagon 37

Price Inquiry
CAT#
G05010
Sequence
SQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
M.W/Mr.
4421.9
Molecular Formula
C192H295N59O60S1
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.