Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

warning All products are for research use only. Not for human use.

Oxyntomodulin / Glucagon 37

[Price Inquiry]
CAT#
G05010
Sequence
SQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
M.W/Mr.
4421.9
Molecular Formula
C192H295N59O60S1
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.