Home > Product > Antimicrobial Peptides > Oxyopinin 1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Oxyopinin 1

[Price Inquiry]
CAT#
AF3242
Sequence
FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ
Host Chemicals
wolf spider Oxyopes kitabensis
Length
48
Activity
Gram+ & Gram-, Mammalian cells,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.