Home > Product > Antimicrobial Peptides > Oxyopinin 1

Antimicrobial Peptides

Oxyopinin 1

Price Inquiry
CAT#
AF3242
Sequence
FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ
Host Chemicals
wolf spider Oxyopes kitabensis
Length
48
Activity
Gram+ & Gram-, Mammalian cells,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.