Home > Product > Catalog Peptides > Others > p53 Tumor Suppressor (361-393), human

Others

warning All products are for research use only. Not for human use.

p53 Tumor Suppressor (361-393), human

[Price Inquiry]
CAT#
C08187
Sequence
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD-NH2
M.W/Mr.
3653.1
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.