Home > Product > Catalog Peptides > Others > P6K

Others

CAT#
P32002
Sequence
ARNDVLGDKENVRPNPYYTEPFDPDTSPEELSALIVDYANMIRNDVILLDNSVETRT
Length
57
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.