Home > Product > Catalog Peptides > Others > PACAP 38, amide, frog

Others

PACAP 38, amide, frog

[Price Inquiry]
CAT#
P08005
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2
M.W/Mr.
4548.4
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.