Home > Product > Catalog Peptides > Others > PACAP 38, amide, frog

Others

PACAP 38, amide, frog

Price Inquiry
CAT#
P08005
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2
M.W/Mr.
4548.4
Length
38

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.