Home > Product > Catalog Peptides > Others > PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)

Others

PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)

[Price Inquiry]
CAT#
P08011
Sequence
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
M.W/Mr.
4024.80
Molecular Formula
C182H300N56O45S
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.