Home > Product > Catalog Peptides > Others > PACAP-27 (human, mouse, ovine, porcine, rat)

Others

PACAP-27 (human, mouse, ovine, porcine, rat)

[Price Inquiry]
CAT#
P08008
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
M.W/Mr.
3147.65
Molecular Formula
C142H224N40O39S
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.