CAT# | P08008 |
M.F/Formula | C142H224N40O39S |
M.W/Mr. | 3147.65 |
Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
Length | 27 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P08001 | [Arg14,20,21, Leu16] PACAP (1-27), human, ovine, rat | Inquiry | ||
P08014 | PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry | ||
P08011 | PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry | ||
P08002 | [Des-Gln16] PACAP (6-27), human, ovine, rat | Inquiry | ||
P08013 | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...