Home > Product > Catalog Peptides > Various Products/Alzheimer's Disease > PACAP-38 (human, mouse, ovine, porcine, rat)

Various Products/Alzheimer's Disease

PACAP-38 (human, mouse, ovine, porcine, rat)

Price Inquiry
CAT#
P08010
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
M.W/Mr.
4534.32
Molecular Formula
C203H331N63O53S
Length
38

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.