Home > Product > Catalog Peptides > Various Products/Alzheimer's Disease > PACAP-38 (human, mouse, ovine, porcine, rat)

Various Products/Alzheimer's Disease

PACAP-38 (human, mouse, ovine, porcine, rat)

[Price Inquiry]
CAT#
P08010
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
M.W/Mr.
4534.32
Molecular Formula
C203H331N63O53S
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.