Home > Product > Antimicrobial Peptides > Palustrin-2CE

Antimicrobial Peptides

Palustrin-2CE

[Price Inquiry]
CAT#
AF2023
Sequence
GLWDSIKNFGKTIALNVMDKIKCKIGGGCPP
Host Chemicals
Rana chensinensis
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.