Home > Product > Antimicrobial Peptides > Palustrin-2ISb precursor protein

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Palustrin-2ISb precursor protein

[Price Inquiry]
CAT#
AF2447
Sequence
LWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE
Host Chemicals
Odorrana ishikawae
Length
35
Activity
Antibacterial, Antifungal
SwissProt ID
G5ELM2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.