Home > Product > Antimicrobial Peptides > Palustrin-3a

Antimicrobial Peptides

Palustrin-3a

Price Inquiry
CAT#
AF3243
Sequence
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
Host Chemicals
North America, Rana palustris
Length
48
Activity
Gram-,
SwissProt ID
SwissProt ID: P84281

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.