Home > Product > Antimicrobial Peptides > Palustrin-3a

Antimicrobial Peptides

Palustrin-3a

[Price Inquiry]
CAT#
AF3243
Sequence
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
Host Chemicals
North America, Rana palustris
Length
48
Activity
Gram-,
SwissProt ID
SwissProt ID: P84281
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.