Home > Product > Antimicrobial Peptides > Palustrin-3AR

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Palustrin-3AR

[Price Inquiry]
CAT#
AF3144
Sequence
GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC
Host Chemicals
Rana areolata
Length
45
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.