Home > Product > Antimicrobial Peptides > Palustrin-3b

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Palustrin-3b

[Price Inquiry]
CAT#
AF3244
Sequence
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGCNEDEC
Host Chemicals
North America, Rana palustris
Length
48
Activity
Gram-,
SwissProt ID
SwissProt ID: P84262
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.