Home > Product > Antimicrobial Peptides > Palustrin-OG1 antimicrobial peptide

Antimicrobial Peptides

Palustrin-OG1 antimicrobial peptide

[Price Inquiry]
CAT#
AF2024
Sequence
GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
Host Chemicals
Odorrana grahami
Length
31
Activity
Antimicrobial
SwissProt ID
A6MBT3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.