Home > Product > Catalog Peptides > Chromogranin A/ Pancreastatin > Pancreastatin, porcine

Chromogranin A/ Pancreastatin

Pancreastatin, porcine

[Price Inquiry]
CAT#
P01002
Sequence
GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
M.W/Mr.
5103.5
Molecular Formula
C214H330N68O76S1
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.