Home > Product > Catalog Peptides > Chromogranin A/ Pancreastatin > Pancreastatin [Tyr0], porcine

Chromogranin A/ Pancreastatin

Pancreastatin [Tyr0], porcine

[Price Inquiry]
CAT#
P01006
Sequence
YGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
M.W/Mr.
5266.4
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.