Home > Product > Catalog Peptides > Others > Pancreatic Polypeptide, avian

Others

Pancreatic Polypeptide, avian

[Price Inquiry]
CAT#
P02003
Sequence
GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2
M.W/Mr.
4237.7
Molecular Formula
C190H283N53O58
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.