Home > Product > Catalog Peptides > Others > Pancreatic Polypeptide (rana temporaria)

Others

Pancreatic Polypeptide (rana temporaria)

[Price Inquiry]
CAT#
P02024
Sequence
APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2
M.W/Mr.
4240.62
Molecular Formula
C192H276N52O58
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.