Home > Product > Catalog Peptides > Others > Pancreatic Polypeptide (rana temporaria)

Others

Pancreatic Polypeptide (rana temporaria)

Price Inquiry
CAT#
P02024
Sequence
APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2
M.W/Mr.
4240.62
Molecular Formula
C192H276N52O58
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.