Home > Product > Antimicrobial Peptides > Papillosin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Papillosin

[Price Inquiry]
CAT#
AF2349
Sequence
GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ
Host Chemicals
Halocynthia papillosa
Length
34
Activity
Antibacterial
SwissProt ID
P86416
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.