Home > Product > Catalog Peptides > Others > Parabutoporin

Others

Parabutoporin

[Price Inquiry]
CAT#
P16001
Sequence
FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ
Length
45
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.