Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-34), human, C-Terminal

Others

Parathyroid Hormone (1-34), human, C-Terminal

[Price Inquiry]
CAT#
P03001
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(FAM-)
M.W/Mr.
4604.3
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.