Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-34), human

Others

Parathyroid Hormone (1-34), human

[Price Inquiry]
CAT#
P03032
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
M.W/Mr.
4117.8
Molecular Formula
C181H291N55O51S2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.