Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-34), rat

Others

Parathyroid Hormone (1-34), rat

Price Inquiry
CAT#
P03027
Sequence
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
M.W/Mr.
4057.8
Molecular Formula
C180H291N55O48S2
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.