Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-34), rat

Others

Parathyroid Hormone (1-34), rat

[Price Inquiry]
CAT#
P03027
Sequence
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
M.W/Mr.
4057.8
Molecular Formula
C180H291N55O48S2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.