Home > Product > Antimicrobial Peptides > Pardaxin 1

Antimicrobial Peptides

Pardaxin 1

[Price Inquiry]
CAT#
AF2182
Sequence
GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE
Host Chemicals
Pardachirus pavoninus
Length
33
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.