Home > Product > Antimicrobial Peptides > Parigidin-br1

Antimicrobial Peptides

Parigidin-br1

[Price Inquiry]
CAT#
AF2092
Sequence
GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
Host Chemicals
Palicourea rigida (Rubiaceae)
Length
32
Activity
Insects, Mammalian cells,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.