Home > Product > Antimicrobial Peptides > pdBD-2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3047
Sequence
YDTGIQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF
Host Chemicals
Chinese loach, Paramisgurnus dabryanus
Length
43
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.