Home > Product > Catalog Peptides > Others > PDH precursor-related peptide

Others

warning All products are for research use only. Not for human use.

PDH precursor-related peptide

[Price Inquiry]
CAT#
P24001
Sequence
QEDLKYFEREVVAELAAQILRVAQGPSAFVAGPH
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.