Home > Product > Antimicrobial Peptides > Pediocin PA-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Pediocin PA-1

[Price Inquiry]
CAT#
AF2475
Sequence
YYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATG
Host Chemicals
Synthetic construct
Length
35
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.