Home > Product > Antimicrobial Peptides > Penaeidin-3n

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Penaeidin-3n

[Price Inquiry]
CAT#
AF3312
Sequence
QGYKGPYTRPILRPYVRPVVSYNACTLSCRGITTTQARSCSTRLGRCCHVAKGYS
Host Chemicals
Atlantic white shrimp, Litopenaeus setiferus (formerly Penaeus setiferus)
Length
55
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: Q962B0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.