Home > Product > Antimicrobial Peptides > Penaeidin-4a

Antimicrobial Peptides

Penaeidin-4a

Price Inquiry
CAT#
AF3218
Sequence
HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
Host Chemicals
Penoeid shrimp, Penaeus vannamei
Length
47
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: Q95NT0

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.