Home > Product > Antimicrobial Peptides > Penaeidin-4a

Antimicrobial Peptides

Penaeidin-4a

[Price Inquiry]
CAT#
AF3218
Sequence
HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
Host Chemicals
Penoeid shrimp, Penaeus vannamei
Length
47
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: Q95NT0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.