Home > Product > Antimicrobial Peptides > Penaeidin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Penaeidin-1

[Price Inquiry]
CAT#
AF3278
Sequence
YRGGYTGPIPRPPPIGRPPLRLVVCACYRLSVSDARNCCIKFGSCCHLVK
Host Chemicals
Penoeid shrimp, Penaeus vannamei
Length
50
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: P81056
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.