Home > Product > Antimicrobial Peptides > Penguin AvBD103a

Antimicrobial Peptides

Penguin AvBD103a

[Price Inquiry]
CAT#
AF2751
Sequence
SFGLCRLRRGSCAHGRCRFPSIPIGRCSRFVQCCRRVW
Host Chemicals
King Penguin stomach, Aptenodytes patagonicus
Length
38
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.