Home > Product > Antimicrobial Peptides > Penguin AvBD103b

Antimicrobial Peptides

Penguin AvBD103b

[Price Inquiry]
CAT#
AF2750
Sequence
SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW
Host Chemicals
Aptenodytes patagonicus
Length
38
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.