Home > Product > Antimicrobial Peptides > Penocin A

Antimicrobial Peptides

CAT#
AF2946
Sequence
KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR
Host Chemicals
Pediococcus pentosaceus ATCC 25745
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.