Home > Product > Catalog Peptides > Others > PEP1

Others

warning All products are for research use only. Not for human use.
CAT#
H05012
Sequence
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
M.W/Mr.
3805.3
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.