Home > Product > Catalog Peptides > Others > Peptide P-A

Others

Peptide P-A

[Price Inquiry]
CAT#
S18003
Sequence
GPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.