Home > Product > Catalog Peptides > Others > Peptide YY (3-36) (canine, mouse, porcine, rat)

Others

Peptide YY (3-36) (canine, mouse, porcine, rat)

Price Inquiry
CAT#
P04006
Sequence
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
M.W/Mr.
3980.41
Molecular Formula
C176H272N52O54
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.