Home > Product > Catalog Peptides > Others > Peptide YY (3-36) (canine, mouse, porcine, rat)

Others

warning All products are for research use only. Not for human use.

Peptide YY (3-36) (canine, mouse, porcine, rat)

[Price Inquiry]
CAT#
P04006
Sequence
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
M.W/Mr.
3980.41
Molecular Formula
C176H272N52O54
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.