Home > Product > Catalog Peptides > Others > Peptide YY (human)

Others

Peptide YY (human)

[Price Inquiry]
CAT#
P04003
Sequence
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
M.W/Mr.
4309.81
Molecular Formula
C194H295N55O57
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.